RP01211
Recombinant Mouse CD28 Protein
Größe
£127.00
- SKU:
- RP01211
- Zusätzliche Namen:
- CD28,Tp44,CD28
- Molekulargewicht:
- 55-70 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Asn20-Lys149
- Formulierung:
- Recombinant Mouse CD28 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn20-Lys149) of mouse CD28 (Accession #NP_031668.3) fused with a Fc, 6xHis tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPK
- Uniprot:
- P31041
- Synonyme:
- T-cell-specific surface glycoprotein CD28
- Versandbedingungen:
- Blue Ice