Recombinant Human IL-2RG/CD132 Protein

Größe

£133.00

SKU:: RP01205
Zusätzliche Namen:: IL2RG,CD132,CIDX,IL-2RG,IMD4,P64,SCIDX,SCIDX1
Molekulargewicht:: 43-65 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Leu23-Asn254
Formulierung:: Recombinant Human IL-2RG/CD132 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Asn254) of human CD132 (Accession #NP_000197.1.) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
Uniprot:: P31785
Synonyme:: CD132;CD132 antigen;CIDX;common cytokine receptor gamma chain;cytokine receptor common subunit gamma;gammaC;IL-2 receptor subunit gamma;IL-2R subunit gamma;IL-2RG;IMD4;interleukin 2 receptor, gamma;Interleukin-2 receptor subunit gamma;nonfunctional common cytokine receptor gamma chain;P64;SCIDX;SCIDX1
Weitere Details:: The gamma chain of the high affinity functional human IL-2 receptor complex belongs to the hematopoietin receptor family. The common gamma chain (G Gammac) (or CD132), also known as interleukin-2 receptor subunit gamma or IL2RG, is a member of the type I cytokine receptor family expressed on most lymphocyte (white blood cell) populations, and its gene is found on the X-chromosome of mammals. IL2RG is a 369 amino acid residue protein consisting of a 22 residue signal sequence, a 232 residue extracellular domain, a 29 residue transmembrane domain and an 86 residue cytoplasmic domain. IL2RG is a cytokine receptor sub-unit that is common to the receptor complexes for at least six different interleukin receptors: IL-2, IL-4, IL-7, IL-9, IL-15 and interleukin-21 receptor. It has been proposed that IL2RG be designated the common gamma chain ( gammac). The site of molecular defects in X-linked SCID (severe combined immunodeficiency) has now been mapped to the IL-2 R gamma gene.

Versandbedingungen:: Blue Ice