RP01190
Recombinant Human LYPD3 Protein

Größe
£127.00
- SKU:
- RP01190
- Zusätzliche Namen:
- LYPD3,C4.4A
- Molekulargewicht:
- 45-70 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Leu31-His286
- Formulierung:
- Recombinant Human LYPD3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu31-His286) of human LYPD3/C4.4A (Accession #NP_055215.2.) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEH
- Uniprot:
- O95274
- Synonyme:
- 2310061G07Rik;C4.4A;GPI-anchored metastasis-associated protein C4.4A homolog;GPI-anchored metastasis-associated protein homolog;ly6/PLAUR domain-containing protein 3;matrigel-induced gene C4 protein;MIG-C4
- Versandbedingungen:
- Blue Ice



