RP01189
Recombinant Human LOX-1/OLR1 Protein
Größe
£127.00
- SKU:
- RP01189
- Zusätzliche Namen:
- OLR1,CLEC8A,LOX1,LOXIN,SCARE1,SLOX1
- Molekulargewicht:
- 30-35 kDa
- Reinheit:
- ≥85%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ser61-Gln273
- Formulierung:
- Recombinant Human LOX-1/OLR1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser61-Gln273) of human LOX-1/OLR1 (Accession #NP_002534.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
- Uniprot:
- P78380
- Synonyme:
- C-type lectin domain family 8 member A;CLEC8A;hLOX-1;Lectin-like oxidized LDL receptor 1;lectin-type oxidized LDL receptor 1;LOX1;LOXIN;ox LDL receptor 1;oxidized low density lipoprotein (lectin-like) receptor 1;oxidized low-density lipoprotein receptor 1;oxidized low-density lipoprotein receptor 1, soluble form;SCARE1;scavenger receptor class E, member 1;SLOX1
- Versandbedingungen:
- Blue Ice