RP01178
Recombinant Human CD3 epsilon Protein
Größe
£145.00
- SKU:
- RP01178
- Zusätzliche Namen:
- CD3E,IMD18,T3E,TCRE,CD3e molecule
- Molekulargewicht:
- 15-25 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Asp126
- Formulierung:
- Recombinant Human CD3 epsilon Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Asp126) of Human CD3 epsilon (Accession #NP_000724.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
- Uniprot:
- P07766
- Synonyme:
- CD3-epsilon;CD3e antigen, epsilon polypeptide (TiT3 complex);CD3e molecule, epsilon (CD3-TCR complex);IMD18;T-cell antigen receptor complex, epsilon subunit of T3;T-cell surface antigen T3/Leu-4 epsilon chain;T-cell surface glycoprotein CD3 epsilon chain;T3E;TCRE
- Versandbedingungen:
- Blue Ice