RP01173
Recombinant Human Flt4 ligand/VEGF-C Protein
Größe
£128.00
- SKU:
- RP01173
- Zusätzliche Namen:
- VEGFC,Flt4-L,LMPH1D,VRP
- Molekulargewicht:
- 19-25 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Thr103-Arg227
- Formulierung:
- Recombinant Human Flt4 ligand/VEGF-C Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr103-Arg227) of human VEGF-C/Flt4-L/VRP (Accession #NP_005420.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- TEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
- Uniprot:
- P49767
- Synonyme:
- Flt4 ligand;FLT4 ligand DHM;Flt4-L;LMPH1D;LMPHM4;vascular endothelial growth factor C;vascular endothelial growth factor-related protein;VRP
- Versandbedingungen:
- Blue Ice