RP01128
Recombinant Human Complement C5A Protein

Größe
£145.00
- SKU:
- RP01128
- Zusätzliche Namen:
- C5, CPAMD4,Complement C5, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4, Cleaved into: Complement C5 beta chain, Complement C5 alpha chain, C5a anaphylatoxin, Complement C5 alpha' chain
- Molekulargewicht:
- 10-15 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Thr678-Arg751
- Formulierung:
- Recombinant Human Complement C5A Protein is produced by E. coli expression system. The target protein is expressed with sequence (Thr678-Arg751) of Human Complement C5A (Accession #NP_001726.2) fused with no tag.
- Spezies:
- Human
- Sequenz:
- LQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
- Uniprot:
- P01031
- Synonyme:
- anaphylatoxin C5a analog;C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4;C5a;C5a anaphylatoxin;C5b;C5D;complement C5;complement component 5;CPAMD4;ECLZB;prepro-C5
- Weitere Details:
- Human Complement 5a (C5a) is an enzymatically generated glycoprotein that belongs to a family of structurally and functionally related proteins known as anaphylatoxins. Human C5a has four alpha -helices plus three intrachain disulfide bonds that create a triple loop structure . In serum, proteolytic processing removes the C-terminal arginine, creating a low activity C5adesArg74 molecule . Human C5a is 60% and 54% aa identical to mouse and rat C5a, respectively. C5a binds to a signaling G-protein coupled receptor (C5aR/CD88) and a nonsignaling GPCR termed C5L2 . Activation of Cd88 results in neutrophil chemotaxis and endothelial cell activation . It also triggers an oxidative burst in macrophages and neutrophils, and induces release of histamine in basophils and mast cells.
- Versandbedingungen:
- Blue Ice

