Recombinant Human IL-20RB Protein

Größe

Auf Anfrage

SKU:: RP01102
Zusätzliche Namen:: IL20RB,DIRS1,FNDC6,IL-20R2
Molekulargewicht:: 60-85 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -70[o]C Aliquot. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Asp30-Ala230
Formulierung:: Recombinant Human IL-20RB Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Asp30-Ala230) of human IL-20RB (Accession #Q6UXL0) fused with an Fc tag at the C-terminus.
Spezies:: Human
Sequenz:: DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA
Uniprot:: Q6UXL0
Synonyme:: DIRS1;fibronectin type III domain containing 6;FNDC6;IL-20 receptor subunit beta;IL-20R-beta;IL-20R2;IL-20RB;interleukin 20 receptor beta subunit;interleukin-20 receptor II;interleukin-20 receptor subunit beta
Weitere Details:: IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]).