RP01086
Recombinant Human PMP2 Protein
Größe
£193.00
- SKU:
- RP01086
- Zusätzliche Namen:
- PMP2,FABP8,M-FABP,MP2,P2
- Molekulargewicht:
- 14-20 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Val132
- Formulierung:
- Recombinant Human PMP2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Val132) of human PMP2 (Accession #P02689) fused with a 6xHis tag at the N-terminus.
- Spezies:
- Human
- Sequenz:
- MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
- Uniprot:
- P02689
- Synonyme:
- CMT1G;FABP8;M-FABP;MP2;myelin P2 protein;P2;Peripheral myelin protein 2
- Weitere Details:
- This protein localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy.
- Versandbedingungen:
- Blue Ice