RP01075
Recombinant Rat IFN-gamma Protein
Größe
£133.00
- SKU:
- RP01075
- Zusätzliche Namen:
- IFN-gamma,Interferon Gamma,IFNG
- Molekulargewicht:
- 50-55 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gln23-Cys156
- Formulierung:
- Recombinant Rat IFN-gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln23-Cys156) of rat Interferon Gamma (Accession #NP_620235.1) fused with an Fc, 6xHis tag at the C-terminus.
- Spezies:
- Rat
- Sequenz:
- QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
- Uniprot:
- P01581
- Synonyme:
- If2f;IFN-gamma;IFNG2;interferon 2f;interferon gamma
- Weitere Details:
- Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.
- Versandbedingungen:
- Blue Ice