Recombinant Mouse TNF-alpha Protein

Größe

£145.00

SKU:: RP01071
Zusätzliche Namen:: DIF, Tnfa, TNF-a, TNFSF2, Tnlg1f, Tnfsf1a, TNFalpha, TNF-alpha,TNF
Molekulargewicht:: 18 kDa
Reinheit:: ≥ 95 % as determined by SDS-PAGE;≥95 %
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Leu80-Leu235
Formulierung:: Recombinant Mouse TNF-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu80-Leu235) of mouse TNF-alpha (Accession #NP_038721.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Mouse
Sequenz:: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Uniprot:: P06804
Synonyme:: cachectin;DI;DIF;Tn;TNF-;TNF-a;TNF-alpha;Tnfa;TNFalpha;Tnfs;Tnfsf1a;TNFSF2;Tnlg1f;tumor necrosis factor;tumor necrosis factor ligand 1f;tumor necrosis factor ligand superfamily member 2;tumor necrosis factor-alpha