RP01038
Recombinant Human IFN-gamma Protein
Größe
£133.00
- SKU:
- RP01038
- Zusätzliche Namen:
- IFNG,IFG,IFI
- Molekulargewicht:
- 17 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gln24-Gln166
- Formulierung:
- Recombinant Human IFN-gamma Protein is produced by E. coli expression system. The target protein is expressed with sequence ( Gln24-Gln166) of human Interferon Gamma (Accession #NP_000610.2).
- Spezies:
- Human
- Sequenz:
- QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
- Uniprot:
- P01579-1
- Synonyme:
- IFG;IFI;IFN-gamma;IMD69;immune interferon;interferon gamma
- Weitere Details:
- Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family.Recombinant Human IFN-gamma is a 16.8 kDa protein containing 143 amino acid residues. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.
- Versandbedingungen:
- Blue Ice