Recombinant Human EGF Protein

Größe

£127.00

SKU:: RP01030
Zusätzliche Namen:: EGF,HOMG4,URG
Molekulargewicht:: 40 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Asn971-Arg1023
Formulierung:: Recombinant Human EGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn 971-Arg 1023) of human EGF (Accession #NP_001954.2) fused with hFc, 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Uniprot:: P01133
Synonyme:: beta-urogastrone;HOMG4;pro-epidermal growth factor;URG
Weitere Details:: Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGF-alpha, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin binding EGF like growth factor (HB_x005f