RP00974
Recombinant Human CD47 Protein
Größe
£133.00
- SKU:
- RP00974
- Zusätzliche Namen:
- CD47, IAP, MER6, OA3, CD47 molecule,IAP,MER6,OA3
- Molekulargewicht:
- 60-70 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gln19-Pro139
- Formulierung:
- Recombinant Human CD47 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln19-Pro139) of human CD47 (Accession #NP_001768.1) fused with an Fc, 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
- Uniprot:
- Q08722
- Synonyme:
- antigen identified by monoclonal antibody 1D8;antigenic surface determinant protein OA3;CD47 antigen (Rh-related antigen, integrin-associated signal transducer);CD47 glycoprotein;IAP;integrin associated protein;Integrin-associated protein;integrin-associated signal transducer;leukocyte surface antigen CD47;MER6;OA3;Protein MER6;Rh-related antigen
- Weitere Details:
- This protein is a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
- Versandbedingungen:
- Blue Ice