RP00915
Recombinant Human Insulin-like 3/INSL3 Protein
Größe
£145.00
- SKU:
- RP00915
- Zusätzliche Namen:
- INSL3,RLF,RLNL,ley-I-L
- Molekulargewicht:
- 13-25 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Leu21-Tyr131
- Formulierung:
- Recombinant Human Insulin-like 3/INSL3 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Leu21-Tyr131) of human INSL3/Insulin-like 3 (Accession #P51460) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
- Uniprot:
- P51460
- Synonyme:
- insulin-like 3;insulin-like 3 (Leydig cell);ley-I-L;leydig insulin -like hormone;leydig insulin-like peptide;prepro-INSL3;Relaxin-like factor;relaxin-like factor b;RLF;RLNL
- Versandbedingungen:
- Blue Ice