RP00870
Recombinant Human IL-17F Protein
Größe
£145.00
- SKU:
- RP00870
- Zusätzliche Namen:
- IL17F,CANDF6,IL-17F,ML-1,ML1
- Molekulargewicht:
- 15-25 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Arg31-Gln163
- Formulierung:
- Recombinant Human IL-17F Protein is produced by Human cells expression system. The target protein is expressed with sequence (Arg31-Gln163) of human IL-17F (Accession #Q96PD4) fused with a His tag at the N-terminus.
- Spezies:
- Human
- Sequenz:
- RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
- Uniprot:
- Q96PD4
- Synonyme:
- CANDF6;cytokine ML-1;IL-17F;interleukin-17F;ML-1;ML1
- Versandbedingungen:
- Blue Ice