RP00825
Recombinant Human LR3-IGF-1(E51R) Protein
Größe
£115.00
- SKU:
- RP00825
- Zusätzliche Namen:
- IGF1, IBP1, IGF-1,Insulin-like growth factor 1, Insulin-like growth factor I, IGF-I, Mechano growth factor, MGF, Somatomedin-C
- Molekulargewicht:
- 10-15 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- MFPAMPLSSLFVNGly49-Ala118 (Glu51Arg)
- Formulierung:
- Recombinant Human LR3-IGF-1(E51R) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly49-Ala118) of human IGF-1 (Accession #P05019) with the substitution of an Arg for Glu at position three and the addition of a thirteen aa N-terminal extension.
- Spezies:
- Human
- Sequenz:
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Uniprot:
- P05019
- Synonyme:
- IGF;IGF-I;IGFI;insulin-like growth factor 1 (somatomedin C);insulin-like growth factor I;insulin-like growth factor IB;mechano growth factor;MGF;somatomedin-C
- Weitere Details:
- Long R3 IGF-1 (LR3 IGF-1) is a synthetic analog of IGF-1 that is generated by modifying the AA sequence for mature human IGF-1. These modifications include the substitution of an Arg for Glu at position three of the mature IGF-1 sequence and the addition of a thirteen aa N-terminal extension, which is derived from methionyl porcine Growth Hormone. These aa changes generate a protein that is still capable of binding to IGF-1 and Insulin receptors, but shows considerably lower affinity binding to IGFBPs compared to wild-type IGF-1. As a result, LR3 IGF-1 has an increased half-life and displays increased biological potency compared to IGF-1.
- Versandbedingungen:
- Blue Ice