Recombinant Human TNFRSF10C/DcR1/TRAIL-R3/CD263 Protein

Größe

£145.00

SKU:: RP00805
Zusätzliche Namen:: TNFRSF10C,CD263,DCR1,DCR1-TNFR,LIT,TRAIL-R3,TRAILR3,TRID
Molekulargewicht:: 38-58 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ala26-Ala221
Formulierung:: Recombinant Human TNFRSF10C/DcR1/TRAIL-R3/CD263 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala26-Ala221) of human TNFRSF10C/DcR1/TRAIL-R3/CD263 (Accession #O14798) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA
Uniprot:: O14798
Synonyme:: antagonist decoy receptor for TRAIL/Apo-2L;CD263;cytotoxic TRAIL receptor-3;DCR1;DCR1-TNFR;decoy receptor 1;decoy TRAIL receptor without death domain;LIT;lymphocyte inhibitor of TRAIL;TNF-related apoptosis-inducing ligand receptor 3;TRAIL receptor without an intracellular domain;TRAIL-R3;TRAILR3;TRID;tumor necrosis factor receptor superfamily member 10C;tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
Weitere Details:: Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) is a glycosyl-phosphatidylinositol-linked membraneprotein which binds TRAIL with high affinity. TNFRSF10C has the TRAIL-binding extracellular cysteine-rich domains, lacks theintracellular signaling domain. As a result, binding of TRAIL to TRAIL R3 doesn ' t transduce an apoptosis signal. Theexpression of TRAIL R3 gene has been shown to protect cells bearing TRAIL R1 and/or TRAIL R2 from TRAIL-inducedapoptosis.

Versandbedingungen:: Blue Ice