RP00791
Recombinant Mouse Pleiotrophin/PTN Protein
Größe
£133.00
- SKU:
- RP00791
- Zusätzliche Namen:
- HBBM|HBGF-8|Heparin-binding brain mitogen|Heparin-binding growth factor 8|OSF-1|Osteoblast-specific factor 1|Pleiotrophin|PTN
- Molekulargewicht:
- 18-20 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gly33-Asp168
- Formulierung:
- Recombinant Mouse Pleiotrophin/PTN Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gly33-Asp168) of mouse Pleiotrophin/PTN (Accession #P63089) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
- Uniprot:
- P63089
- Synonyme:
- HARP;HB-GA;HB-GAM;HBBM;HBBN;HBGF-8;HBN;HBNF;heparin-binding brain mitogen;heparin-binding growth factor 8;heparin-binding growth-associated molecule;heparin-binding neutrophic factor;Os;OSF;Osf-1;Osf1;osteoblast-specific factor 1;pleiotrophin
- Weitere Details:
- Pleiotrophin (PTN) is a secreted, strongly heparinbinding, developmentally regulated cytokine. PTN is a highlyconserved protein , Human, mouse, rat, canine, porcine, equine and bovine PTN share 98% aa sequenceidentity or greater. PTN and midkine share 50% amino acid (aa) sequence identity, share some functions, andconstitute a family. During development, PTN is involved in development of brain, bone, and organsundergoing branching morphogenesis. PTN causes PTPRB dimerization and inactivates its phosphatase activity,which allows increased tyrosine phosphorylation of its substrates. Increased expression of PTN is correlatedwith neuronal development or stresses such as brain ischemia and Parkinson's disease.
- Versandbedingungen:
- Blue Ice