RP00782LQ
Recombinant Human RAMP3(M33L) Protein
Größe
£163.00
- SKU:
- RP00782LQ
- Zusätzliche Namen:
- RAMP3,Receptor activity-modifying protein 3,RAMP3-H
- Molekulargewicht:
- 25-35 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Arg24-Val118
- Formulierung:
- Recombinant Human RAMP3(M33L) Protein is produced by CHO Cells system. The target protein is expressed with sequence (Arg24-Val118) of Human RAMP3 (Accession #NP_005847.1) fused with His tag at the C-Terminus.
- Spezies:
- Human
- Sequenz:
- RAGGCNETGLLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEV
- Uniprot:
- O60896
- Synonyme:
- calcitonin receptor-like receptor activity modifying protein 3;Calcitonin-receptor-like receptor activity-modifying protein 3;CRLR activity-modifying protein 3;receptor (calcitonin) activity modifying protein 3;receptor (G protein-coupled) activity modifying protein 3;receptor activity-modifying protein 3
- Weitere Details:
- RAMP3 belongs to the RAMP family. Accessory protein that interacts with and modulates the function of G-protein coupled receptors including calcitonin gene-related peptide type 1 receptor (CALCRL), calcitonin receptor (CALCR) and G-protein coupled estrogen receptor 1 (GPER1) .Required for the transport of CALCRL and GPER1 receptors to the plasma membrane .Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner.Together with CALCRL, form a receptor complex for adrenomedullin/ADM and intermedin/ADM2 .Together with CALCR, act as a receptor complex for amylin/IAPP.
- Versandbedingungen:
- Dry Ice