RP00765
Recombinant Mouse IFN-alpha 6 Protein

Größe
£133.00
- SKU:
- RP00765
- Zusätzliche Namen:
- Ifna6, If1ai11, Interferon 1ai11, Interferon alpha 6
- Molekulargewicht:
- 15-25 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Cys24-Glu189
- Formulierung:
- Recombinant Mouse IFN-alpha 6 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Cys24-Glu189) of Mouse IFN-alpha 6(Accession #NP_996754.1) fused with His tag at the C-Terminus.
- Spezies:
- Mouse
- Sequenz:
- CDLPQTHNLRNKKALTLLVQMRRLSPLSCLKDRKDFGFPLEKVDAQQIQEAQAIPVLTELTQQILTLFTSKDSSAAWNATLLDSFCNDLHQQLNDLKACVMQEVGVQESPLTQEDSLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAKLLARLSEDE
- Synonyme:
- If;If1ai11;Ifa6;Ifa8;IFN-alpha-6;IFN-alpha-8;Ifna8;IFNa8/6;interferon 1ai11;interferon alpha 8/6;interferon alpha family, gene 6;interferon alpha family, gene 8;interferon alpha-6;interferon alpha-8
- Weitere Details:
- Mature mouse IFNA6 consists of 166 aa and shares 60% aa identity with human IFNA6. The type I IFNs binds to the interferon alpha receptor (IFNAR) which consists of two subunits: IFNAR1 (alpha -subunit) and IFNAR2 (beta -subunit) . Individual IFN alpha subtypes are known to display unique efficacies to viral protection, with IFNA6 displaying the superior efficacy controlling influenza virus infection and disease . Treatment with IFNA6 DNA 2 weeks post-MCMV infection proved effective at inhibiting the development of chronic autoimmune myocarditis. IFNA6 is also able to reduce chronic cardiac inflammation. These findings suggest that immunomodulation of both antiviral and autoimmune responses by IFN DNA immunization may be an avenue for improved viral immunotherapy .
- Versandbedingungen:
- Blue Ice

