RP00764
Recombinant Human BLNK Protein

Größe
£145.00
- SKU:
- RP00764
- Zusätzliche Namen:
- BLNK, BASH, SLP65,B-cell linker protein
- Molekulargewicht:
- 75-100 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Ser456
- Formulierung:
- Recombinant Human BLNK Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Met1-Ser456) of Human BLNK(Accession #NP_037446.1) fused with His tag at the N-Terminus.
- Spezies:
- Human
- Sequenz:
- MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS
- Uniprot:
- Q8WV28
- Synonyme:
- AGM4;B cell adaptor containing SH2 domain;B-cell activation;B-cell adapter containing a SH2 domain protein;B-cell adapter containing a Src homology 2 domain protein;B-cell linker protein;BASH;bca;BLNK-S;cytoplasmic adapter protein;LY57;SLP-65;SLP65;Src homology [SH2] domain-containing leukocyte protein of 65 kD;Src homology 2 domain-containing leukocyte protein of 65 kDa
- Weitere Details:
- BLNK functions as a central linker protein that bridges kinases associated with the B-cell receptor (BCR) with a multitude of signaling pathways, regulating biological outcomes of B-cell function and development. BLNK plays a role in the activation of ERK / EPHB2, MAP kinase p38 and JNK. BLNK modulates AP1 activation. It is important for the activation of NF-kappa-B and NFAT. BLNK plays an important role in BCR-mediated PLCG1 and PLCG2 activation and Ca2+mobilization and is required for trafficking of the BCR to late endosomes. BLNK may be required for the RAC1-JNK pathway. It plays a critical role in orchestrating the pro-B cell to pre-B cell transition. BLNK also plays an important role in BCR-induced B-cell apoptosis.Defects in BLNK are the cause of agammaglobulinemia type 4 (AGM4) which is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B cells due to an early block of B-cell development.
- Versandbedingungen:
- Blue Ice

