RP00756
Recombinant Mouse IFN-alpha 4 Protein
Größe
£133.00
- SKU:
- RP00756
- Zusätzliche Namen:
- Ifna4, Interferon alpha-4, IFN-alpha-4
- Molekulargewicht:
- 20-30 KDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Leu23-Glu186
- Formulierung:
- Recombinant Mouse IFN-alpha 4 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Leu23-Glu186) ofMouse IFN-alpha 4(Accession #NP_034634.1) fused with His tag at the C-Terminus.
- Spezies:
- Mouse
- Sequenz:
- LGCDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDLKACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSSTNLLARLSEEKE
- Uniprot:
- P07351
- Synonyme:
- If;If1ai13;Ifa4;IFN-alpha-4;interferon 1ai13;interferon alpha family, gene 4;interferon alpha-4;MuIFN-alpha 4
- Weitere Details:
- The interferons (IFN) are a family of cytokines with potent antiviral, antiproliferative and immunomodulatory properties, and are classified based on their binding specificity to cell surface receptors . The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 ( alpha -subunit) and IFNAR2 ( beta -subunit). This binding contributes to TNF-alpha induced signaling .
- Versandbedingungen:
- Blue Ice