Recombinant Human HB-EGF Protein

Größe

£127.00

SKU:: RP00754
Zusätzliche Namen:: DTR, DTS, DTSF, HEGFL,HBEGF,DTS,DTSF,HEGFL|HB-EGF
Molekulargewicht:: 15-25 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Leu20-Leu148
Formulierung:: Recombinant Human HB-EGF Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Leu20-Leu148) of human HB-EGF (Accession #Q99075) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
Uniprot:: Q99075
Synonyme:: diphtheria toxin receptor (heparin-binding EGF-like growth factor);diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor);DTR;DTS;DTSF;HEGFL;heparin-binding epidermal growth factor;proheparin-binding EGF-like growth factor
Weitere Details:: Heparin-binding EGF-like growth factor (HB-EGF) is a 12-16 kDa member of the epidermal growth factor (EGF)family. It possesses an EGF-like domain, and a heparin-binding motif. Mature HB-EGF is a soluble peptide thatarises from proteolytic processing of the transmembrane form. Human HB -EGF shows 76% and 73% aasequence identity with rat and mouse HB-EGF, respectively. It is required for normal cardiac valve formationand normal heart function, promotes smooth muscle cell proliferation. It may be involved in macrophage-mediated cellular proliferation; it is mitogenic for fibroblasts, but not endothelial cells. HB-EGF classified as agroup 2 ErbB ligand based on its ability to activate both the EGF/ErbB1 and ErbB4 receptors. Activityassociated with ErbB4 binding appears to be limited to non -mitogenic actions, while EGFR binding inducesboth mitogenic and non-mitogenic activity.

Versandbedingungen:: Blue Ice