Recombinant Human Mature BMP-9/GDF-2 Protein

Größe

£223.00

SKU:: RP00722
Zusätzliche Namen:: GDF2, BMP9,Growth/differentiation factor 2, GDF-2, Bone morphogenetic protein 9, BMP-9
Molekulargewicht:: 10-20 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ser320-Arg429
Formulierung:: Recombinant Human Mature BMP-9/GDF-2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser320-Arg429) of Human Mature BMP-9/GDF-2 (Accession # Q9UK05) fused with no tag.
Spezies:: Human
Sequenz:: SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
Uniprot:: Q9UK05
Synonyme:: BMP-9;BMP9;bone morphogenetic protein 9;growth/differentiation factor 2;HHT5
Weitere Details:: BMP-9 is a member of the BMP subgroup of the TGF-beta superfamily proteins that signal through heterodimeric complexes composed of type I and type II BMP receptors. GDF-2 Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG. ALK1 is a signalling receptor for bone morphogenetic protein-9 (BMP-9) in endothelial cells (ECs). BMP-9 bound with high affinity to ALK1 and endoglin, and weakly to the type-I receptor ALK2 and to the BMP type-II receptor (BMPR-II) and activin type-II receptor (ActR-II) in transfected COS cells.

Versandbedingungen:: Blue Ice