RP00703
Recombinant Human Brain Natriuretic Peptide/NT-proBNP Protein
Größe
£145.00
- SKU:
- RP00703
- Zusätzliche Namen:
- NPPB,BNP
- Molekulargewicht:
- 35-60 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- His27-Pro104
- Formulierung:
- Recombinant Human Brain Natriuretic Peptide/NT-proBNP Protein Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His27-Pro104) of human Brain Natriuretic Peptide/BNP (Accession #P16860) fused with a hFC tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSP
- Uniprot:
- P16860
- Synonyme:
- BNP;brain natriuretic factor prohormone;brain type natriuretic peptide;gamma-brain natriuretic peptide;Iso-ANP;natriuretic peptide precursor B;natriuretic peptides B;natriuretic protein;preproBNP;proBNP
- Weitere Details:
- Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly byventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNPprecursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriureticpeptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from theventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF)and atrial septal defect in patients without HF.
- Versandbedingungen:
- Blue Ice