RP00699
Recombinant Human S100-B Protein
Größe
£127.00
- SKU:
- RP00699
- Zusätzliche Namen:
- NEF,S100,S100-B,S100beta,S100B,S100 beta
- Molekulargewicht:
- 40-45 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ser2-Glu92
- Formulierung:
- Recombinant Human S100-B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu92) of human S100 Calcium Binding Protein B/S100B (Accession #P04271) fused with an initial Met at the N-terminus and a 6xHis tag at the N-terminus.
- Spezies:
- Human
- Sequenz:
- SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
- Uniprot:
- P04271
- Synonyme:
- NEF;protein S100-B;S-100 calcium-binding protein, beta chain;S-100 protein beta chain;S-100 protein subunit beta;S100;S100 calcium-binding protein B;S100 calcium-binding protein, beta (neural);S100-B;S100beta
- Weitere Details:
- S100-B, is an acidic protein with a molecular weight of 21 kDa belonging to the S100 family. S100-B containstwo EF-hand-type calcium-binding motifs separated by a hinge region with a hydrophobic cleft. S100-B playsan important role in neurodevelopment, differentiation, and brain construction. S100-B has neuroprotectiveeffects, but at high concentrations S100-B is neurotoxic. Extracellular concentration of S100-B increasesfollowing brain damage, which easily penetrates into cerebrospinal fluid in brain damage and then into theblood. S100-B is expressed and produced by astrocytes in vertebrate brains and in the CNS, and the astrocytesare the major cells producing S100-B protein in gray matter, as well as oligodendrocytes are the predominantS100-B in protein producing cells in white matter. The major advantage of using S100-B is that elevations inserum or CSF levels provide a sensitive measure for determining CNS injury at the molecular level before grosschanges develop, enabling timely delivery of crucial medical intervention before irreversible damage occurs. Inaddition, S100-B, which is also present in human melanocytes, is a reliable marker for melanoma malignancyboth in bioptic tissue and in serum.
- Versandbedingungen:
- Blue Ice