RP00666
Recombinant Mouse IL-1Ra/IL-1F3/IL-1RN Protein
Größe
£193.00
- SKU:
- RP00666
- Zusätzliche Namen:
- IL-1ra, F630041P17Rik,IL1RN
- Molekulargewicht:
- 15-25 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Arg27-Gln178
- Formulierung:
- Recombinant Mouse IL-1Ra/IL-1F3/IL-1RN Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg27-Gln178) of mouse IL-1Ra/IL-1F3/IL-1RN (Accession #P25085) fused with an initial Met at the N-terminus.
- Spezies:
- Mouse
- Sequenz:
- RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
- Uniprot:
- P25085
- Synonyme:
- F630041P17Rik;IL;IL-1ra;IL-1RN;IL1 inhibitor;interleukin-1 receptor antagonist protein;IRAP
- Weitere Details:
- Interleukin-1 receptor antagonist protein (Il1rn), also known as IL-1ra, IRAP or IL1 inhibitor, is a member of theinterleukin 1 cytokine family. This protein inhibits the activities of interleukin 1 alpha (IL1A) and interleukin 1beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. The mouseIl1rn gene encodes a 178 amino acids (aa) protein with a 26 aa signal peptide. Mouse Il1rn protein shares 26%and 19% identity with its homologues IL-1 beta and IL-1 alpha, respectively. Il1rn can Inhibits the activity ofinterleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP forsignaling, but has no interleukin-1 like activity. Recently, an recombinant human Il1rn protein is used in thetreatment of rheumatoid arthritis, an autoimmune disease in which IL-1 plays a key role.
- Versandbedingungen:
- Blue Ice