Biotinylated Recombinant Human MMP-9 Protein

Größe

£657.00

SKU:: RP00646B
Zusätzliche Namen:: MMP9, CLG4B,MMP-9,Matrix metalloproteinase-9
Molekulargewicht:: 95-105 kDa
Reinheit:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ala20-Asp707
Formulierung:: Biotinylated Recombinant Human MMP-9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala20-Asp707) of Human MMP-9 (Accession #P14780) fused with a C-His&Avi tag at the C-terminus.
Spezies:: Human
Sequenz:: APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Uniprot:: P14780
Synonyme:: 92 kDa gelatinase;92 kDa type IV collagenase;CLG4B;Gelatinase B;GELB;macrophage gelatinase;MANDP2;matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase);matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase);matrix metalloproteinase-9;MMP-9;type V collagenase
Weitere Details:: Matrix metalloproteinase 9 (MMP9) contributes to this process and deficiencies in the MMP9 lead to impaired healing. Inappropriate expression of MMP9 also contributes to impaired re-epithelialization. Previously we demonstrated that FOXO1 was activated in wound healing but to higher levels in diabetic wounds. To address mechanisms of impaired re-epithelialization we examined MMP9 expression in vivo in full thickness dermal scalp wounds created in experimental K14.

Versandbedingungen:: Blue Ice