Recombinant Human/Mouse/Rat mature TGF-beta 3 Protein

Größe

£193.00

SKU:: RP00645
Zusätzliche Namen:: TGFB3,ARVD,ARVD1,LDS5,RNHF,TGF-beta3
Molekulargewicht:: 13-16 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ala301-Ser412(Y340F)
Formulierung:: Recombinant Human/Mouse/Rat TGF-beta 3 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala301-Ser412(Tyr340Phe)) of human TGF-beta 3/TGFB3 (Accession #P10600).
Spezies:: Human
Sequenz:: ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Uniprot:: P10600
Synonyme:: ARVD;ARVD1;LDS5;prepro-transforming growth factor beta-3;RNHF;TGF-beta3;transforming growth factor beta-3 proprotein
Weitere Details:: Transforming growth factor beta 3(TGFB3) is a member of a TGF - B Beta superfamily which is defined bytheirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form ofTGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subsetofintegrins. It binds with high affinity to TGF- B Beta RII, a type II serine/threonine kinase receptor. TGFB3 is involvedincell differentiation, embryogenesis and development.It is believed to regulate molecules involved incellularadhesion and extracellular matrix (ECM) formation during the process of palate development. WithoutTGF-B Beta3,mammals develop a deformity known as a cleft palate.

Versandbedingungen:: Blue Ice