RP00617B
Biotinylated Recombinant Human TNFRSF17/BCMA/CD269 Trimer Protein
Größe
£657.00
- SKU:
- RP00617B
- Zusätzliche Namen:
- BCM|BCMA|CD269|TNFRSF13A|TNFRSF17
- Molekulargewicht:
- 35-50 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE.≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Ala54
- Formulierung:
- Biotinylated Recombinant Human TNFRSF17/BCMA/CD269 Trimer Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ala54) of Human TNFRSF17/BCMA/CD269 Trimer (Accession #Q02223) fused with a C-His&Avi tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
- Uniprot:
- Q02223
- Synonyme:
- B cell maturation antigen;B-cell maturation factor;B-cell maturation protein;BCM;BCMA;CD269;TNFRSF13A;tumor necrosis factor receptor superfamily member 17
- Weitere Details:
- B-cell maturation antigen (BCMA or BCM), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17), is a protein that in humans is encoded by the TNFRSF17 gene.TNFRSF17 is a cell surface receptor of the TNF receptor superfamily which recognizes B-cell activating factor (BAFF).
- Versandbedingungen:
- Blue Ice