Recombinant Human Transcriptional Repressor Ctcf/CTCF Protein

Größe

£193.00

SKU:: RP00606
Zusätzliche Namen:: CTCF, MRD21, CCCTC-binding factor,MRD21,CTCF
Molekulargewicht:: 35-40 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Ile154
Formulierung:: Recombinant Human Transcriptional Repressor Ctcf/CTCF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ile154) of Human Transcriptional Repressor Ctcf/CTCF (Accession #P49711)fused with no tag.
Spezies:: Human
Sequenz:: MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMI
Uniprot:: P49711
Synonyme:: 11 zinc finger transcriptional repressor;11-zinc finger protein;CCCTC-binding factor;CCCTC-binding factor (zinc finger protein);CFAP108;CTCFL paralog;FAP108;MRD21;transcriptional repressor CTCF
Weitere Details:: Transcriptional Repressor CTCF (CTCF) belongs to the CTCF Zinc-Finger Protein family. CTCF contains twelveC2H2-type zinc fingers and interacts with CHD8. CTCF is widely expressed in many tissues, and it is absent inprimary spermatocytes. CTCF is involved in transcriptional regulation by binding to chromatin insulators andpreventing interaction between promoter and nearby enhancers and silencers. CTCF plays an essential role inoocyte and preimplantation embryo development by activating or repressing transcription. In addition, CTCF isalso indispensable in the epigenetic regulation and chromatin remodeling.

Versandbedingungen:: Blue Ice