RP00586
Recombinant Human CD8 alpha Protein
Größe
£431.00
- SKU:
- RP00586
- Zusätzliche Namen:
- CD8|CD8a|CD8a molecule|Leu2|Lyt-2|MAL|OKT8 T-cell antigen|p32
- Molekulargewicht:
- 28-35 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ser22-Asp182
- Formulierung:
- Recombinant Human CD8 alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Asp182) of Human CD8 alpha (Accession #P01732-1) fused with a C-His tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
- Uniprot:
- P01732-1
- Synonyme:
- CD8;CD8 antigen, alpha polypeptide (p32);Leu2;Leu2 T-lymphocyte antigen;OKT8 T-cell antigen;p32;T cell co-receptor;T-cell antigen Leu2;T-cell surface glycoprotein CD8 alpha chain;T-lymphocyte differentiation antigen T8/Leu-2;T8 T-cell antigen
- Weitere Details:
- CD8 alpha enhances the responses of antigen-specific CTL activated through TCR through binding MHC class I, favoring lipid raft partitioning of TCR, and inducing intracellular signaling. CD8 alpha is also found on dendritic cells and rat macrophages, but whether CD8 alpha enhances responses of a partner receptor, like TCR, to activate these cells is not known.
- Versandbedingungen:
- Blue Ice