Recombinant Human CD3E&CD3G Protein

Größe

£508.00

SKU:: RP00582
Zusätzliche Namen:: CD3|CD3 epsilon&CD3 gamma|CD3e|CD3E&CD3G|CD3G|T3G
Molekulargewicht:: 45-60 kDa
Reinheit:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Asp23-Asp126(CD3E) & Gln23-Ser116(CD3G)
Formulierung:: Recombinant Human CD3E&CD3G/CD3 epsilon&CD3 gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp23-Asp126(CD3E) & Gln23-Ser116(CD3G)) of Human CD3E&CD3G/CD3 epsilon&CD3 gamma (Accession #P07766(CD3E)&P09693(CD3G)) fused with a C-hFc tag at the C-terminus.
Spezies:: Human
Sequenz:: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS
Uniprot:: P07766, P09693
Synonyme:: CD3-epsilon;CD3-GAMMA;CD3e antigen, epsilon polypeptide (TiT3 complex);CD3e molecule, epsilon (CD3-TCR complex);CD3g antigen, gamma polypeptide (TiT3 complex);CD3g molecule, epsilon (CD3-TCR complex);CD3g molecule, gamma (CD3-TCR complex);IMD17;IMD18;T-cell antigen receptor complex, epsilon subunit of T3;T-cell antigen receptor complex, gamma subunit of T3;T-cell receptor T3 gamma chain;T-cell surface antigen T3/Leu-4 epsilon chain;T-cell surface glycoprotein CD3 epsilon chain;T-cell surface glycoprotein CD3 gamma chain;T3E;T3G;TCRE
Weitere Details:: T-cell surface glycoprotein CD3 epsilon & CD3 gamma chain, also known as CD3E & CD3G , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.

Versandbedingungen:: Blue Ice