RP00572
Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein
Größe
£276.00
- SKU:
- RP00572
- Zusätzliche Namen:
- CD28|CD28 antigen|CD28 antigen (Tp44)|CD28 molecule|MGC138290|T-cell-specific surface glycoprotein CD28|Tp44
- Molekulargewicht:
- 55-70 kDa
- Spezies-Reaktivität:
- Human, Non-human Primate
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Asn19-Pro152
- Formulierung:
- Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn19-Pro152) of Human/Cynomolgus/Rhesus-macaque CD28 (Accession #P10747-1) fused with hFc tag at the N-terminus.
- Spezies:
- Human, Non-human Primate
- Sequenz:
- NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
- Uniprot:
- P10747-1
- Synonyme:
- T-cell-specific surface glycoprotein CD28;Tp44
- Weitere Details:
- CD28 is the receptor for CD80 (B7-1) and CD86 (B7-2) proteins.When activated by Toll-like receptor ligands, the CD80 expression is upregulated in antigen presenting cells (APCs). The CD86 expression on antigen presenting cells is constitutive. CD28 is the only B7 receptor constitutively expressed on naive T cells.
- Versandbedingungen:
- Blue Ice