RP00528B
Biotinylated Recombinant Human CD47 Protein
Größe
£657.00
- SKU:
- RP00528B
- Zusätzliche Namen:
- CD47|CD47 glycoprotein|CD47 molecule|IAP|MER6|OA3
- Molekulargewicht:
- 55-70 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gln19-Pro139
- Formulierung:
- Biotinylated Recombinant Human CD47 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Pro139) of Human CD47 (Accession #Q08722-1) fused with a C-hFc&Avi tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
- Uniprot:
- Q08722-1
- Synonyme:
- antigen identified by monoclonal antibody 1D8;antigenic surface determinant protein OA3;CD47 antigen (Rh-related antigen, integrin-associated signal transducer);CD47 glycoprotein;IAP;integrin associated protein;Integrin-associated protein;integrin-associated signal transducer;leukocyte surface antigen CD47;MER6;OA3;Protein MER6;Rh-related antigen
- Weitere Details:
- CD47 (Cluster of Differentiation 47) also known as integrin associated protein (IAP) is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 belongs to the immunoglobulin superfamily and partners with membrane integrins and also binds the ligands thrombospondin-1 (TSP-1) and signal-regulatory protein alpha (SIRPA Alpha).CD-47 acts as a don't eat me signal to macrophages of the immune system which has made it a potential therapeutic target in some cancers.
- Versandbedingungen:
- Blue Ice