RP00526B
Biotinylated Recombinant Human TNFSF7/CD27 Ligand/CD70 Trimer Protein (Primary Amine Labeling)
Größe
£657.00
- SKU:
- RP00526B
- Zusätzliche Namen:
- ?Ki-24 antigen|CD27 Ligand|CD27-L|CD27LG|CD70|CD70 molecule|TNFSF7|TNFSF7G
- Molekulargewicht:
- 55-70 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Leu50-Pro193
- Formulierung:
- Biotinylated Recombinant Human TNFSF7/CD27 Ligand/CD70 Trimer Protein (Primary Amine Labeling) is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu50-Pro193) of Human TNFSF7/CD27 Ligand/CD70 Trimer (Primary Amine Labeling) (Accession #P32970-1) fused with a N-His tag at the N-terminus.
- Spezies:
- Human
- Sequenz:
- LESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
- Uniprot:
- P32970-1
- Synonyme:
- CD27 ligand;CD27-L;CD27L;CD27LG;CD70 antigen;Ki-24 antigen;LPFS3;surface antigen CD70;TNFSF7;TNLG8A;tumor necrosis factor ligand 8A;tumor necrosis factor ligand superfamily member 7
- Weitere Details:
- CD70, also named CD27 ligand (CD27L), is a type II transmembrane glycoprotein belonging to the TNF superfamily (TNFSF) and has been designated TNFSF7.? CD70 is a cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
- Versandbedingungen:
- Blue Ice