Recombinant Human CEACAM5/CEA/CD66e (323-500) Protein

Größe

£431.00

SKU:: RP00518
Zusätzliche Namen:: Carcinoembryonic|CD66e|CEA|CEACAM-5|CEACD66e
Molekulargewicht:: 45-60 kDa
Reinheit:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Pro323-Leu500
Formulierung:: Recombinant Human CEACAM5/CEA/CD66e (323-500) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro323-Leu500) of Human CEACAM5/CD66e (323-500) (Accession #P06731-1) fused with a C-His tag at the C-terminus.
Spezies:: Human
Sequenz:: PKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAEL
Uniprot:: P06731-1
Synonyme:: Carcinoembryonic antigen;carcinoembryonic antigen related cell adhesion molecule 5;carcinoembryonic antigen-related cell adhesion molecule 5;CD66e;CEA;meconium antigen 100
Weitere Details:: Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5) was identified as a metastatic driver. CEACAM5 overproduction enriched for an epithelial gene expression pattern and facilitated tumor outgrowth at metastatic sites. Tissues from patients with metastatic breast cancer confirmed elevated levels of CEACAM5 in lung metastases relative to breast tumors, and an inverse correlation between CEACAM5 and the mesenchymal marker vimentin was demonstrated.

Versandbedingungen:: Blue Ice