Recombinant Human FAM3C Protein

Größe

£145.00

SKU:: RP00514
Zusätzliche Namen:: FAM3C,GS3786,ILEI
Molekulargewicht:: 20-25 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gln25-Asp227
Formulierung:: Recombinant Human FAM3C Protein is produced by Human cells expression system. The target protein is expressed with sequence (Gln25-Asp227) of human FAM3C (Accession #Q92520) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
Uniprot:: Q92520
Synonyme:: family with sequence similarity 3 member C;GS3786;ILEI;interleukin-like EMT inducer;interleukin-like epithelial-mesenchymal transition inducer;predicted osteoblast protein;protein FAM3C
Weitere Details:: FAM3C, also called interleukin-like EMT inducer, usually exist in most secretory epithelia. It belongs to theFAM3 family according to their sequence similarities. The up-regulation and/or mislocalization in breast cancerand liver carcinoma cells of FAM3C is strongly correlated with metastasis formation and survival. FAM3C can beinvolved in retinal laminar formation and promote epithelial to mesenchymal transition.