RP00500B
Biotinylated Recombinant Human HER1/ERBB1/EGFR (25-378) Protein
Größe
£657.00
- SKU:
- RP00500B
- Zusätzliche Namen:
- EC 2.7.10|EC 2.7.10.1|EGFR|ErbB|ERBB1|HER1|LEGFR|mENA|NISBD2|PIG61
- Molekulargewicht:
- 60-78 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Leu25-Ser378
- Formulierung:
- Biotinylated Recombinant Human ERBB1/HER1/EGFR (25-378) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Ser378) of Human ERBB1/HER1/EGFR (25-378) (Accession #NP_001333870.1) fused with a C-His&Avi tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS
- Synonyme:
- avian erythroblastic leukemia viral (v-erb-b) oncogene homolog;cell growth inhibiting protein 40;cell proliferation-inducing protein 61;epidermal growth factor receptor;epidermal growth factor receptor tyrosine kinase domain;erb-b2 receptor tyrosine kinase 1;ERBB;ERBB1;ERRP;HER1;mENA;NISBD2;PIG61;proto-oncogene c-ErbB-1;receptor tyrosine-protein kinase erbB-1
- Weitere Details:
- The epidermal growth factor receptor (EGFR) is overexpressed in a variety of human epithelial tumors, often as a consequence of gene amplification. Tumors with EGFR gene amplification frequently contain EGFR gene rearrangements, with the most common extracellular domain mutation being EGFRvIII. This mutation leads to a deletion of exons 2-7 of the EGFR gene and renders the mutant receptor incapable of binding any known ligand.
- Versandbedingungen:
- Blue Ice