Biotinylated Recombinant Human ERBB2/HER2/CD340 (489-630) Protein

Größe

£657.00

SKU:: RP00493B
Zusätzliche Namen:: CD340|EGFR2|ENV|ENVW|ErbB2|ERVWE1|HER-2|HER2|herstatin|HERV7Q|HERVW|MLN 19|MLN19|NEU|NGL|TKR1
Molekulargewicht:: 28-40 kDa
Reinheit:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Pro489-Cys630
Formulierung:: Biotinylated Recombinant Human ERBB2/HER2/CD340 (489-630) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro489-Cys630) of Human ERBB2/HER2/CD340 (489-630) (Accession #P04626-1) fused with a C-His&Avi tag at the C-terminus.
Spezies:: Human
Sequenz:: PHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINC
Uniprot:: P04626-1
Synonyme:: c-erb B2/neu protein;CD340;HER-2;HER-2/neu;HER2;herstatin;human epidermal growth factor receptor 2;metastatic lymph node gene 19 protein;MLN 19;NEU;neuro/glioblastoma derived oncogene homolog;neuroblastoma/glioblastoma derived oncogene homolog;NGL;p185erbB2;proto-oncogene c-ErbB-2;proto-oncogene Neu;receptor tyrosine-protein kinase erbB-2;TKR1;tyrosine kinase-type cell surface receptor HER2;v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2;v-erb-b2 avian erythroblastic leukemia viral oncoprotein 2;v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog;VSCN2
Weitere Details:: ErbB2, also called Neu and Her2 (human epidermal growth factor receptor 2), is a type I membrane glycoprotein that is a member of the ErbB family of tyrosine kinase receptors. ErbB family members serve as receptors for the epidermal growth factor (EGF) family of growth factors.Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane.

Versandbedingungen:: Blue Ice