RP00481
Recombinant Human Fc gamma RIIA/FCGR2A/CD32a Protein
Größe
£336.00
- SKU:
- RP00481
- Zusätzliche Namen:
- CD32A|Fc gamma RIIA|FCG2|FCGR2|FCGR2A|FCGR2A1|FcgRIIA|fcRII-a|FCRIIA
- Molekulargewicht:
- 30-40 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala36-Ile218
- Formulierung:
- Recombinant Human Fc gamma RIIA/FCGR2A/CD32a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala36-Ile218) of Human Fc gamma RIIA/CD32a (Accession #P12318-1) fused with a C-His&Avi tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
- Uniprot:
- P12318-1
- Synonyme:
- CD32;CD32A;CDw32;Fc fragment of IgG, low affinity IIa, receptor (CD32);Fc gamma receptor RIIa3;Fc-gamma RII-a;fc-gamma-RIIa;FCG2;FcGR;FCGR2;FCGR2A1;fcRII-a;IGFR2;igG Fc receptor II-a;Immunoglobulin G Fc receptor II;low affinity immunoglobulin gamma Fc region receptor II-a
- Weitere Details:
- The Fc gamma Rs have been divided into three classes based on close relationships in their extracellular domains; these groups are designated Fc gamma RI (also known as CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Each group may be encoded by multiple genes and exist in different isoforms depending on species and cell type.
- Versandbedingungen:
- Blue Ice