Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein

Größe

£300.05

War £353.00

SKU:: RP00471
Zusätzliche Namen:: CD16|CD16B|CD16b (NA2)|Fc gamma RIIIB|FCG3|FCG3B|FCGR3|FCGR3B|FcgRIIIB|FCR-10|FCRIIIB|IGFR3
Molekulargewicht:: 47-53 kDa
Reinheit:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gly17-Ser200(NA2)
Formulierung:: Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly17-Ser200) of Human Fc-gamma RIII beta/FCGR3B/CD16b (Accession #O75015-1) fused with a C-His&Avi tag at the C-terminus.
Spezies:: Human
Sequenz:: GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS
Uniprot:: O75015-1
Synonyme:: CD16;CD16A;CD16b;Fc fragment of IgG, low affinity IIIb, receptor (CD16b);Fc gamma receptor III-B;Fc gamma receptor IIIb;Fc-gamma receptor IIIb (CD 16);fc-gamma RIII-beta;fc-gamma RIIIb;FCG3;FCGR3;FCGR3A;FCR-10;FCRIII;FCRIIIb;igG Fc receptor III-1;low affinity immunoglobulin gamma Fc region receptor III-B
Weitere Details:: Human Fc gamma RIIIB/CD16b Protein is a receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.

Versandbedingungen:: Blue Ice