Recombinant Human B7-H3 (4Ig)/B7-H3b/CD276 Protein

Größe

£395.00

SKU:: RP00469
Zusätzliche Namen:: 4Ig-B7-H3|B7 homolog 3|B7-H3|CD276|PRO352|PSEC0249|UNQ309
Molekulargewicht:: 80-110 kDa
Reinheit:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gly27-Thr461
Formulierung:: Recombinant Human B7-H3 (4Ig)/B7-H3b/CD276 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly27-Thr461) of Human B7-H3 (4Ig)/B7-H3b/CD276 (Accession #Q5ZPR3-1) fused with a C-hFc tag at the C-terminus.
Spezies:: Human
Sequenz:: GALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT
Uniprot:: Q5ZPR3-1
Synonyme:: 4Ig-B7-H3;B7 homolog 3;B7-H3;B7H3;B7RP-2;CD276 antigen;costimulatory molecule
Weitere Details:: B7-H3, a member of the B7 family of immunomodulatory molecules, is overexpressed in a wide range of solid cancers.B7-H3 binds to activated T cells via an as yet unidentified receptor. In assays using sub-optimal amount so anti-CD3 stimulation, 2Ig?B7?H3 enhances T cell proliferation, T cell interferon-gamma (IFN-gamma) production, and cytotoxic T cells induction.

Versandbedingungen:: Blue Ice