RP00468
Recombinant Human FcRn/FCGRT&B2M Protein
Größe
£431.00
- SKU:
- RP00468
- Zusätzliche Namen:
- FCGRT|FCGRT&B2M|FCRN|FcRn alpha chain
- Molekulargewicht:
- 35-40 kDa (FCGRT), 13-14 kDa (B2M)
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala24-Ser297(FCGRT) & Ile21-Met119(B2M)
- Formulierung:
- Recombinant Human FcRn/FCGRT&B2M Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Ser297)&(Ile21-Met119) of Human FcRn/FCGRT&B2M (Accession #P55899-1&P61769-1) fused with a C-His tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDR
- Uniprot:
- P55899-1, P61769-1
- Synonyme:
- alpha-chain;Fc fragment of IgG, receptor, transporter, alpha;FCRN;FcRn alpha chain;heavy chain of the major histocompatibility complex class I-like Fc receptor;IgG Fc fragment receptor transporter alpha chain;IgG receptor FcRn large subunit p51;immunoglobulin receptor, intestinal, heavy chain;major histocompatibility complex class I-like Fc receptor;neonatal Fc receptor;neonatal Fc-receptor for Ig;transmembrane alpha chain of the neonatal receptor
- Weitere Details:
- The neonatal Fc receptor (FCRN) is an approximately 45 kDa transmembrane glycoprotein with structural homology to MHC class I proteins. It is widely expressed in endothelial and epithelial cells and plays an important role in IgG homeostasis and antigen presentation by dendritic cells.FCGRT & B2M heterodimer protein (FcRn complex) consist of two subunits: p51, and p14 , and forms an MHC class I-like heterodimer.
- Versandbedingungen:
- Blue Ice