Recombinant Human TNFRSF1B/TNF-R2/CD120b Protein

Größe

£353.00

SKU:: RP00364
Zusätzliche Namen:: CD120b|Etanercept|p75TBPII|p75TNFR|TBPII|TNF RII|TNF-R2|TNF-R75|TNFBR|TNFR1B|TNFR2|TNFR80|TNFRSF1B
Molekulargewicht:: 48-60 kDa
Reinheit:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Leu23-Asp257
Formulierung:: Recombinant Human TNFRSF1B/TNF-R2/CD120b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Asp257) of Human TNFR2/CD120b/TNFRSF1B (Accession #P20333-1) fused with a C-His tag at the C-terminus.
Spezies:: Human
Sequenz:: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
Uniprot:: P20333-1
Synonyme:: CD120b;p75;p75 TNF receptor;p75TNFR;p80 TNF-alpha receptor;soluble TNFR1B variant 1;TBPII;TNF-R-II;TNF-R2;TNF-R75;TNF-RII;TNFBR;TNFR1B;TNFR2;TNFR80;tumor necrosis factor beta receptor;tumor necrosis factor binding protein 2;tumor necrosis factor receptor 2;tumor necrosis factor receptor superfamily member 1B;tumor necrosis factor receptor type II
Weitere Details:: Tumor Necrosis Factor Receptor II (TNF RII), also known as TNFRSF1B, p75/p80, and CD120b, is a type I transmembrane protein that belongs to the TNF receptor superfamily. It has a molecular weight of approximately 75 kDa.Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.

Versandbedingungen:: Blue Ice