RP00363B
Biotinylated Recombinant Human TNFRSF4/OX40/CD134 Protein
Größe
£657.00
- SKU:
- RP00363B
- Zusätzliche Namen:
- ACT-135|CD134|IMD16|Ly-70|OX40|OX40 homologue|OX40L receptor|TNFRSF4|TXGP1L
- Molekulargewicht:
- 50-55 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Leu29-Ala216
- Formulierung:
- Biotinylated Recombinant Human TNFRSF4/OX40/CD134 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Ala216) of Human OX40/TNFRSF4/CD134 (Accession #P43489) fused with a C-His&Avi tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
- Uniprot:
- P43489
- Synonyme:
- ACT35;ACT35 antigen;ATC35 antigen;CD134;CD134 antigen;IMD16;lymphoid activation antigene ACT35;OX40;OX40 antigen;OX40 cell surface antigen;OX40 homologue;OX40L receptor;TAX transcriptionally-activated glycoprotein 1 receptor;tax-transcriptionally activated glycoprotein 1 receptor;tumor necrosis factor receptor superfamily member 4;TXGP1L
- Weitere Details:
- Tumor necrosis factor receptor superfamily, member 4 (TNFRSF4), also known as CD134 and OX40 receptor. OX40 is a secondary co-stimulatory immune checkpoint molecule, expressed after 24 to 72 hours following activation; its ligand, OX40L, is also not expressed on resting antigen presenting cells, but is following their activation.
- Versandbedingungen:
- Blue Ice