Recombinant Human TNFSF9/4-1BB Ligand Trimer Protein

Größe

£395.00

SKU:: RP00360
Zusätzliche Namen:: 4-1BB Ligand|4-1BBL|41BB Ligand|CD137L|TNFSF9
Molekulargewicht:: 84 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Arg71-Glu254
Formulierung:: Recombinant Human TNFSF9/4-1BB Ligand Trimer Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg71-Glu254) of Human TNFSF9/4-1BB Ligand Trimer (Accession #P41273) fused with a N-monomeric hFc tag at the N-terminus.
Spezies:: Human
Sequenz:: REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Uniprot:: P41273
Synonyme:: 4-1BB ligand;4-1BB-L;4-1BBL;CD137 ligand;CD137L;homolog of mouse 4-1BB-L;receptor 4-1BB ligand;TNLG5A;tumor necrosis factor (ligand) superfamily, member 9;tumor necrosis factor ligand 5A;tumor necrosis factor ligand superfamily member 9;tumor necrosis factor superfamily member 9
Weitere Details:: The 4-1BBL is the high affinity ligand of 4-1BB, also known as CD137L or TNFSF9. 4-1BB ligand (4-1BBL) is an inducible molecule present on several APC types, including B cells, macrophages and DCs.4-1BB:4-1BBL pathway seems to amplify the existing costimulatory signals, even if the engagement of 4-1BB in the presence of a strong TCR signaling can induce IL-2 production in a CD28-independent manner.

Versandbedingungen:: Blue Ice