RP00351
Recombinant Human CXCL5/ENA-70 Protein
Größe
£145.00
- SKU:
- RP00351
- Zusätzliche Namen:
- CXCL5,ENA-78,SCYB5
- Molekulargewicht:
- 15-20 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala37-Asn114
- Formulierung:
- Recombinant Human CXCL5/ENA-70 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala37-Asn114) of human CXCL5/ENA-70 (Accession #P42830) fused with a His tag at the c-terminus.
- Spezies:
- Human
- Sequenz:
- AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
- Uniprot:
- P42830
- Synonyme:
- C-X-C motif chemokine 5;chemokine (C-X-C motif) ligand 5;ENA-78;ENA-78(1-78);epithelial-derived neutrophil-activating protein 78;neutrophil-activating peptide ENA-78;neutrophil-activating protein 78;SCYB5;small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78);Small-inducible cytokine B5
- Weitere Details:
- This protein belongs a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion.
- Versandbedingungen:
- Blue Ice