RP00349
Recombinant Human NKp46/NCR1/CD335 Protein
Größe
£395.00
- SKU:
- RP00349
- Zusätzliche Namen:
- CD335|Ly94|MAR-1|NCR1|NKp46|NKP46FLJ99094
- Molekulargewicht:
- 65-75 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gln22-Asn255
- Formulierung:
- Recombinant Human NKp46/NCR1/CD335 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Asn255) of Human NKp46/NCR1/CD335 (Accession #O76036-1) fused with a C-mFc tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQN
- Uniprot:
- O76036-1
- Synonyme:
- CD335;LY94;Lymphocyte antigen 94 homolog;lymphocyte antigen 94 homolog (activating NK-receptor; NK-p46);natural cytotoxicity triggering receptor 1;natural killer cell p46-related protein;NK cell-activating receptor;NK-p46;NKP46
- Weitere Details:
- NKp46, along with NKp30 and NKp44, are activating receptors that have been collectively termed the natural cytotoxicity receptors (NCR).These receptors lack significant sequence homology to one another. They are expressed almost exclusively by NK cells and play a major role in triggering some of the key lytic activities of NK cells.
- Versandbedingungen:
- Blue Ice